PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0016s0241.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family NF-YA
Protein Properties Length: 183aa    MW: 20025.4 Da    PI: 10.1268
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0016s0241.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.73.9e-33105161158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep++VNaKQy++Il+RRq+Rak+e+e+kl +ksrkpylheSRh hAlrR+Rg+gGrF
  Kalax.0016s0241.2.p 105 EEPVFVNAKQYHGILRRRQSRAKAESENKL-AKSRKPYLHESRHLHALRRARGCGGRF 161
                          69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.1E-36103164IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.283104164IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.3E-28106161IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.6E-23107129IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860109129IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.6E-23138161IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MTSTVHHSGQ QKQSEHGIHA AAAGTGISHP DITNIANVPF PTPSHLGVGH AQAAYPFPDP  60
YYRSIFTSHE AQPYPAQPYS PQPMVHMQLM GIQQAGLPLP SDVVEEPVFV NAKQYHGILR  120
RRQSRAKAES ENKLAKSRKP YLHESRHLHA LRRARGCGGR FLNAKKNENS QQNESTSGGS  180
SH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-21104169166NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002282043.18e-88PREDICTED: nuclear transcription factor Y subunit A-7
RefseqXP_010655736.18e-88PREDICTED: nuclear transcription factor Y subunit A-7
SwissprotQ84JP19e-58NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLD7TKH69e-88D7TKH6_VITVI; Putative uncharacterized protein
STRINGVIT_10s0003g04650.t013e-87(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.23e-56nuclear factor Y, subunit A7